missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CABS1 Polyclonal specifically detects CABS1 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | CABS1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | C4orf35, calcium-binding protein, spermatid-specific 1, calcium-binding protein, sperm-specific 1, casein-like phosphoprotein, chromosome 4 open reading frame 35, CLPH, FLJ32897, NYD-SP26, Testis development protein NYD-SP26 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CABS1 (NP_149113). Peptide sequence TTITSEGDHVTSVNEYMLESDFSTTTDNKLTAKKEKLKSEDDMGTDFIKS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?