missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAB39L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | CAB39L |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18344543
|
Novus Biologicals
NBP3-17812-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18317432
|
Novus Biologicals
NBP3-17812-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CAB39L Polyclonal antibody specifically detects CAB39L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CAB39L | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology | |
| PBS, pH 7.2, 40% glycerol | |
| 81617 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Antigen MLAA-34, bA103J18.3, calcium binding protein 39-like, calcium-binding protein 39-like, FLJ12577, MO25-BETA, Mo25-like protein, MO2L, RP11-103J18.3, sarcoma antigen NY-SAR-79, U937-associated antigen | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title