missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C9orf71 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | C9orf71 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18344694
|
Novus Biologicals
NBP3-16962-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18340922
|
Bio-Techne
NBP3-16962-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
C9orf71 Polyclonal antibody specifically detects C9orf71 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| C9orf71 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C9orf71, chromosome 9 open reading frame 71, RP11-274B18.1, transmembrane protein 252 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 169693 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title