missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C9orf64 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C9orf64 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C9orf64 Polyclonal specifically detects C9orf64 in Human samples. It is validated for Western Blot.Specifications
| C9orf64 | |
| Polyclonal | |
| Rabbit | |
| NP_115683 | |
| 84267 | |
| Synthetic peptide directed towards the N terminal of human C9orf64. Peptide sequence RVEGWKALHELNPRAADEAAVNWVFVTDTLNFSFWSEQDEHKCVVRYRGK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 9 open reading frame 64, hypothetical protein LOC84267, RP11-575L7.5 | |
| C9orf64 | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title