missing translation for 'onlineSavingsMsg'
Learn More

C9orf103 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18343334 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18343334 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18343334 Supplier Novus Biologicals Supplier No. NBP310712100UL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Rabbit Polyclonal Antibody

C9orf103 Polyclonal specifically detects C9orf103 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen C9orf103
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias bA522I20.2, C9orf103, chromosome 9 open reading frame 103, EC 2.7.1.12, glucokinase-like protein, Gluconate kinase, gluconokinase-like protein, hGntK, idnK, gluconokinase homolog (E. coli), probable gluconokinase
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human C9orf103 (NP_001001551). Peptide sequence LLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRD
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 414328
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.