missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beskrivning
C9orf103 Polyclonal specifically detects C9orf103 in Human samples. It is validated for Western Blot.
Specifikationer
Specifikationer
| Antigen | C9orf103 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | bA522I20.2, C9orf103, chromosome 9 open reading frame 103, EC 2.7.1.12, glucokinase-like protein, Gluconate kinase, gluconokinase-like protein, hGntK, idnK, gluconokinase homolog (E. coli), probable gluconokinase |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human C9orf103 (NP_001001551). Peptide sequence LLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRD |
| Purification Method | Affinity purified |
| Visa mer |
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?