missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C6orf223 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C6orf223 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C6orf223 Polyclonal specifically detects C6orf223 in Human samples. It is validated for Western Blot.Specifications
| C6orf223 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 221416 | |
| Synthetic peptides corresponding to MGC45491 The peptide sequence was selected from the middle region of MGC45491. Peptide sequence CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGARLMRSNYPPPL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 6 open reading frame 223 | |
| C6orf223 | |
| IgG | |
| 26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title