missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C5orf4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | C5orf4 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C5orf4 Polyclonal specifically detects C5orf4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| C5orf4 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| 10826 | |
| Synthetic peptides corresponding to C5ORF4 The peptide sequence was selected from the N terminal of C5ORF4. Peptide sequence MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| chromosome 5 open reading frame 4, FLJ13758, hypothetical protein LOC10826 | |
| C5ORF4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title