missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. C5orf30 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

C5orf30 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Product Code. 18384027 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18384027 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18384027 Supplier Novus Biologicals Supplier No. NBP310736100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

C5orf30 Polyclonal specifically detects C5orf30 in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen C5orf30
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias chromosome 5 open reading frame 30, FLJ25291, hypothetical protein LOC90355
Host Species Rabbit
Immunogen The immunogen for Anti-C5orf30 antibody is: synthetic peptide directed towards the N-terminal of Mouse CE030 (XP_006529815.1). Peptide sequence TLPLPVAEGSSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGF
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 90355
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.