missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C4orf33 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C4orf33 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C4orf33 Polyclonal specifically detects C4orf33 in Human samples. It is validated for Western Blot.Specifications
| C4orf33 | |
| Polyclonal | |
| Rabbit | |
| Q8N1A6 | |
| 132321 | |
| Synthetic peptides corresponding to C4ORF33 The peptide sequence was selected from the C terminal of C4ORF33. Peptide sequence PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 4 open reading frame 33, FLJ33703, hypothetical protein LOC132321 | |
| C4ORF33 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title