C4 binding protein A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Produktcode	Marke	Quantity
30228259	Novus Biologicals NBP3-38450-100ul	100 μL
30231358	Novus Biologicals NBP3-38450-20ul	20 μL

Beschreibung

C4 binding protein A Polyclonal antibody specifically detects C4 binding protein A in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Spezifikation

• Antigen: C4 binding protein A
• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Immunology, Innate Immunity
• Formulation: PBS (pH 7.3), 50% glycerol
• Gene ID (Entrez): 722
• Isotype: IgG
• Purification Method: Affinity purified

• Dilution: Western Blot 1:1000 - 1:5000, ELISA
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: C4b binding protein, alpha chain, C4b-binding protein alpha chain, C4BP, complement component 4 binding protein, alpha, complement component 4 binding protein, alpha chain, complement component 4-binding protein, alpha, Proline-rich protein, PRP
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4 binding protein A (NP_000706.1).,, Sequence:, QYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
• Primary or Secondary: Primary
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.