missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C3orf62 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | C3orf62 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C3orf62 Polyclonal specifically detects C3orf62 in Human samples. It is validated for Western Blot.Specifications
| C3orf62 | |
| Polyclonal | |
| Rabbit | |
| chromosome 3 open reading frame 62, FLJ43654, hypothetical protein LOC375341, MGC23381, MGC61663, MGC62079 | |
| C3ORF62 | |
| IgG | |
| 30 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 375341 | |
| Synthetic peptides corresponding to C3ORF62 The peptide sequence was selected from the middle region of C3ORF62. Peptide sequence IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title