missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. C3orf62 Antibody, Novus Biologicals™

C3orf62 Antibody, Novus Biologicals™

Codice prodotto. 18408720 Sfoglia Tutto Bio Techne Prodotti
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
0.1 mL
25 μL
missing translation for 'unitSize'
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantity unitSize
18408720 25 μL 25µL
18293767 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Questo articolo non è restituibile. Consulta la politica di reso
Codice prodotto. 18408720 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP18189925ul

Please to purchase this item. Need a web account? Register with us today!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

C3orf62 Polyclonal specifically detects C3orf62 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifica

Antigen C3orf62
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100 - 1:250, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias chromosome 3 open reading frame 62, FLJ43654, hypothetical protein LOC375341, MGC23381, MGC61663, MGC62079
Gene Symbols C3ORF62
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CAPENENPAFATNHAPVNAKPHALCPERKPLTSKENVLMHSSILAPERESWRTAGEGENWRKENLRKDMERDLKADSNMPLNNSSQEVTKDLLDMIDH
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 375341
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.