missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C3orf49 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C3orf49 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C3orf49 Polyclonal specifically detects C3orf49 in Human samples. It is validated for Western Blot.Specifications
| C3orf49 | |
| Polyclonal | |
| Rabbit | |
| chromosome 3 open reading frame 49, MGC17310 | |
| C3ORF49 | |
| IgG | |
| 33 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 132200 | |
| Synthetic peptides corresponding to C3orf49 (chromosome 3 open reading frame 49) The peptide sequence was selected from the middle region of C3orf49. Peptide sequence IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title