missing translation for 'onlineSavingsMsg'
Learn More

C1qTNF4/CTRP4 Antibody, Novus Biologicals™

Product Code. 18419820 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18419820 0.1 mL 0.10mL
18476090 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18419820 Supplier Novus Biologicals Supplier No. NBP184335

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

C1qTNF4/CTRP4 Polyclonal antibody specifically detects C1qTNF4/CTRP4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen C1qTNF4/CTRP4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias C1q and tumor necrosis factor related protein 4, complement C1q tumor necrosis factor-related protein 4, complement-c1q tumor necrosis factor-related protein 4, CTRP4ZACRP4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFT
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline metabolism, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 114900
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.