missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C1qTNF3/CORS26/CTRP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | C1qTNF3/CORS26/CTRP3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18260744
|
Novus Biologicals
NBP2-57665 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18638356
|
Novus Biologicals
NBP2-57665-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
C1qTNF3/CORS26/CTRP3 Polyclonal specifically detects C1qTNF3/CORS26/CTRP3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| C1qTNF3/CORS26/CTRP3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 114899 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| C1ATNF3, C1q and tumor necrosis factor related protein 3, cartonectin, collagenous repeat-containing sequence of 26-kDa, complement C1q tumor necrosis factor-related protein 3, complement-c1q tumor necrosis factor-related protein 3, Corcs, Cors, Cors-26, CORS26, CTRP32310005P21Rik, FLJ37576, Secretory protein CORS26 | |
| C1QTNF3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title