missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C1orf74 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C1orf74 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C1orf74 Polyclonal specifically detects C1orf74 in Human samples. It is validated for Western Blot.Specifications
| C1orf74 | |
| Polyclonal | |
| Rabbit | |
| chromosome 1 open reading frame 74 | |
| C1ORF74 | |
| IgG | |
| 29 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 148304 | |
| Synthetic peptides corresponding to C1ORF74 The peptide sequence was selected from the N terminal of C1ORF74. Peptide sequence ICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLH. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title