missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C1D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48673
This item is not returnable.
View return policy
Description
C1D Polyclonal antibody specifically detects C1D in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| C1D | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| C1D DNA-binding protein, C1D nuclear receptor corepressor, C1D nuclear receptor co-repressor, hC1D, MGC12261, MGC14659, nuclear DNA-binding protein, nuclear nucleic acid-binding protein C1D, small unique nuclear receptor corepressor, small unique nuclear receptor co-repressor, SUN-CoR, SUNCORLRP1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGK | |
| 0.1 mL | |
| DNA replication Transcription Translation and Splicing | |
| 10438 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction