missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C16orf58 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | C16orf58 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
C16orf58 Polyclonal specifically detects C16orf58 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| C16orf58 | |
| Unconjugated | |
| RUO | |
| chromosome 16 open reading frame 58, FLJ13868, hypothetical protein LOC64755 | |
| C16ORF58 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| Q96GQ5 | |
| 64755 | |
| Synthetic peptides corresponding to C16ORF58 The peptide sequence was selected from the N terminal of C16ORF58. Peptide sequence QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title