missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C11orf16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | C11orf16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C11orf16 Polyclonal specifically detects C11orf16 in Human samples. It is validated for Western Blot.Specifications
| C11orf16 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| chromosome 11 open reading frame 16, hypothetical protein LOC56673 | |
| C11ORF16 | |
| IgG | |
| 51 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_065694 | |
| 56673 | |
| Synthetic peptide directed towards the middle region of human C11orf16. Peptide sequence EPCLGKPGTRYSNICKEEKDHKQQRAQTAVVGTTKELVSKATHMKPPRTP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title