C10orf67 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55273-25ul

Product Code. 18619616

Description

C10orf67 Polyclonal specifically detects C10orf67 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: C10orf67
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: chromosome 10 open reading frame 67, hypothetical protein LOC256815, MGC46732, RP11-792P23.2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: C10ORF67
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EELDQYKDFGFHKMESFAKETSSPKSNLEKENLEYKVENERLLQIISELEEEIQINLKENSGLEDELISMKEMAEKDHKTIQK
• Quantity: 25 μL
• Research Discipline: Base Excision Repair, Cancer, Chromatin Research, DNA Repair, Modulation of DNA Pools, Stem Cell Markers
• Gene ID (Entrez): 256815
• Target Species: Human
• Isotype: IgG

For Research Use Only