missing translation for 'onlineSavingsMsg'
Learn More
Learn More
c-Myc Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£232.00 - £419.00
Specifications
| Antigen | c-Myc |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18217292
|
Novus Biologicals
NBP2-56660 |
100 μL |
£419.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18654068
|
Novus Biologicals
NBP2-56660-25ul |
25 μL |
£232.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
c-Myc Polyclonal specifically detects c-Myc in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifikationer
| c-Myc | |
| Polyclonal | |
| Rabbit | |
| Human | |
| avian myelocytomatosis viral oncogene homolog, BHLHE39, bHLHe39MRTL, Class E basic helix-loop-helix protein 39, c-Myc, MYC, myc proto-oncogene protein, MYCC, myc-related translation/localization regulatory factor, Proto-oncogene c-Myc, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog, v-myc myelocytomatosis viral oncogene homolog (avian) | |
| MYC | |
| IgG | |
| Affinity Purified | |
| 67 kDa |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4609 | |
| This antibody was developed against a c-Myc Antibody recombinant protein corresponding to the following amino acid sequence: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel