missing translation for 'onlineSavingsMsg'
Learn More
Learn More
c-Maf Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92429-0.1ml
This item is not returnable.
View return policy
Description
c-Maf Polyclonal antibody specifically detects c-Maf in Human samples. It is validated for Western Blot
Specifications
| c-Maf | |
| Polyclonal | |
| Western Blot 1:1000-1:3000 | |
| Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene, c-MAF, c-maf proto-oncogene, MGC71685, Proto-oncogene c-Maf, T lymphocyte c-maf long form, transcription factor Maf, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene homolog, V-maf musculoaponeurotic fibrosarcoma oncogene homolog, v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK | |
| 0.1 mL | |
| Apoptosis, Cancer, Cell Biology, Immunology | |
| 4094 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction