missing translation for 'onlineSavingsMsg'
Learn More

c-Maf Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18687420 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18687420 0.1 mL 0.1mL
18637661 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18687420 Supplier Novus Biologicals Supplier No. NBP2924290.1ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

c-Maf Polyclonal antibody specifically detects c-Maf in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen c-Maf
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000-1:3000
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene, c-MAF, c-maf proto-oncogene, MGC71685, Proto-oncogene c-Maf, T lymphocyte c-maf long form, transcription factor Maf, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene homolog, V-maf musculoaponeurotic fibrosarcoma oncogene homolog, v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Biology, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 4094
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.