c-Maf Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92429-0.02ml

Product Code. 18637661

Description

c-Maf Polyclonal antibody specifically detects c-Maf in Human samples. It is validated for Western Blot

Specifications

• Antigen: c-Maf
• Classification: Polyclonal
• Dilution: Western Blot 1:1000-1:3000
• Gene Alias: Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene, c-MAF, c-maf proto-oncogene, MGC71685, Proto-oncogene c-Maf, T lymphocyte c-maf long form, transcription factor Maf, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene homolog, V-maf musculoaponeurotic fibrosarcoma oncogene homolog, v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian)
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
• Quantity: 0.02 mL
• Research Discipline: Apoptosis, Cancer, Cell Biology, Immunology
• Gene ID (Entrez): 4094
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified