missing translation for 'onlineSavingsMsg'
Learn More
Learn More
c-Maf Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £359.00
Specifications
| Antigen | c-Maf |
|---|---|
| Dilution | Western Blot 1:1000-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18617251
|
Novus Biologicals
NBP2-92085-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18657140
|
Novus Biologicals
NBP2-92085-0.1ml |
0.1 mL |
£359.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
c-Maf Polyclonal antibody specifically detects c-Maf in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| c-Maf | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Immunology | |
| PBS with 50% glycerol, pH7.3. | |
| 4094 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene, c-MAF, c-maf proto-oncogene, MGC71685, Proto-oncogene c-Maf, T lymphocyte c-maf long form, transcription factor Maf, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene homolog, V-maf musculoaponeurotic fibrosarcoma oncogene homolog, v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title