missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18379048

BUD31 Antibody, Novus Biologicals™

Product Code. 18379048 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18379048 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18379048 Supplier Novus Biologicals Supplier No. H00008896B02P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

BUD31 Polyclonal antibody specifically detects BUD31 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen BUD31
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_003901.2
Gene Alias BUD31 homolog (S. cerevisiae), BUD31 homolog (yeast), EDG-2, EDG2MGC111202, fSAP17, functional spliceosome-associated protein 17, G10, G10 maternal transcript homolog, maternal G10 transcript, protein BUD31 homolog, Protein EDG-2, Protein G10 homolog, YCR063W
Host Species Mouse
Immunogen BUD31 (NP_003901.2, 1 a.a. - 144 a.a.) full-length human protein. MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
Purification Method Protein G purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 8896
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.