missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRUNOL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | BRUNOL5 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18427691
|
Novus Biologicals
NBP1-89931-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18261266
|
Novus Biologicals
NBP1-89931 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BRUNOL5 Polyclonal specifically detects BRUNOL5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| BRUNOL5 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 60680 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYAN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Bruno (Drosophila) -like 5, RNA binding protein, BRUNOL-5, BRUNOL5bruno-like 5, RNA binding protein (Drosophila), bruno-like 5 RNA binding protein, Bruno-like protein 5, CELF-5, CUG-BP and ETR-3 like factor 5, CUG-BP- and ETR-3-like factor 5, CUGBP Elav-like family member 5, CUGBP, Elav-like family member 5, RNA-binding protein BRUNOL-5 | |
| CELF5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title