BRUNOL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35858-100ul

Product Code. 30231253

Description

BRUNOL5 Polyclonal antibody specifically detects BRUNOL5 in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: BRUNOL5
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: Bruno (Drosophila) -like 5, RNA binding protein, BRUNOL-5, BRUNOL5bruno-like 5, RNA binding protein (Drosophila), bruno-like 5 RNA binding protein, Bruno-like protein 5, CELF-5, CUG-BP and ETR-3 like factor 5, CUG-BP- and ETR-3-like factor 5, CUGBP Elav-like family member 5, CUGBP, Elav-like family member 5, RNA-binding protein BRUNOL-5
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-45 of human BRUNOL5 (NP_001166144.1).,, Sequence:, MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAI
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified

• Applications: ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 60680
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG