BRSK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38935-25ul

Product Code. 18634346

Description

BRSK1 Polyclonal specifically detects BRSK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BRSK1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q8TDC3
• Gene Symbols: BRSK1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BR serine/threonine kinase 1, EC 2.7.11, EC 2.7.11.1, FLJ43009, KIAA1811BR serine/threonine-protein kinase 1, protein kinase SAD1A, SAD1, SAD1 kinase, Serine/threonine-protein kinase SAD-B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84446
• Target Species: Human
• Isotype: IgG