missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
BRP44L Polyclonal specifically detects BRP44L in Rat samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | BRP44L |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | brain protein 44-like, brain protein 44-like protein, CGI-129, dJ68L15.3, HSPC040 protein |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat BRP44L (NP_598245). Peptide sequence GALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIIS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?