missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
BRP44L Polyclonal specifically detects BRP44L in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockout Validated.
Specifications
Specifications
| Antigen | BRP44L |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoassay |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockout Validated |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | brain protein 44-like, brain protein 44-like protein, CGI-129, dJ68L15.3, HSPC040 protein |
| Gene Symbols | MPC1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?