BRM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80042

Product Code. 18705543

Description

BRM Polyclonal specifically detects BRM in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BRM
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: SMARCA2
• Immunogen: Synthetic peptide directed towards the middle region of human SMARCA2. Peptide sequence VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6595
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Alias: ATP-dependent helicase SMARCA2, BAF190B, BRG1-associated factor 190B, BRMFLJ36757, EC 3.6.1, EC 3.6.4.-, global transcription activator homologous sequence, hBRMMGC74511, hSNF2a, probable global transcription activator SNF2L2, Protein brahma homolog, SNF2, SNF2/SWI2-like protein 2, SNF2A, SNF2-alpha, SNF2L2BAF190, SNF2LA, SNF2-like 2, Sth1p, subfamily a, member 2, sucrose nonfermenting 2-like protein 2, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 2, SWI2
• Host Species: Rabbit
• Molecular Weight of Antigen: 32 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only