missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRI3BP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-62385
This item is not returnable.
View return policy
Description
BRI3BP Polyclonal specifically detects BRI3BP in Human samples. It is validated for Western Blot.
Specifications
| BRI3BP | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| BNAS1, BRI3 binding protein, BRI3-binding protein, Cervical cancer 1 proto-oncogene-binding protein KG19, cervical cancer oncogene binding protein, HCCR-1, HCCR-2, HCCRBP-1, KG19I3-binding protein | |
| Rabbit | |
| 28 kDa | |
| 100 μL | |
| Primary | |
| Pig: 86%; Bovine: 79%. | |
| Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8WY22 | |
| BRI3BP | |
| Synthetic peptides corresponding to BRI3BP(BRI3 binding protein) The peptide sequence was selected from the C terminal of BRI3BP. Peptide sequence GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK. | |
| Affinity purified | |
| RUO | |
| 140707 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction