missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Breast carcinoma amplified sequence 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | Breast carcinoma amplified sequence 3 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18246475
|
Novus Biologicals
NBP2-58584 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18675676
|
Novus Biologicals
NBP2-58584-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Breast carcinoma amplified sequence 3 Polyclonal specifically detects Breast carcinoma amplified sequence 3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Breast carcinoma amplified sequence 3 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| BCAS4/BCAS3 fusion, breast carcinoma amplified sequence 3, breast carcinoma amplified sequence 4/3 fusion protein, breast carcinoma-amplified sequence 3, DKFZp686O1527, FLJ20128, GAOB1, MAAB, metastasis associated antigen of breast cancer, MGC4973, protein Maab1 | |
| BCAS3 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 54828 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title