missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
BRD8 Monoclonal antibody specifically detects BRD8 in Human samples. It is validated for ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | BRD8 |
| Applications | ELISA, Immunocytochemistry |
| Classification | Monoclonal |
| Clone | 3G8 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_631938 |
| Gene Alias | bromodomain containing 8, bromodomain-containing protein 8, Skeletal muscle abundant protein, SMAP2, SMAPp120Skeletal muscle abundant protein 2, Thyroid hormone receptor coactivating protein of 120 kDa, trCP120 |
| Host Species | Mouse |
| Immunogen | BRD8 (NP_631938, 33 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?