missing translation for 'onlineSavingsMsg'
Learn More

BRD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£231.00 - £484.00

Specifications

Antigen	BRD2
Concentration	0.1mg/mL
Dilution	Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification	Polyclonal

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18476600 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-84310-25ul	25 μL	£231.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18269816 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-84310	0.1 mL	£484.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

BRD2 Polyclonal specifically detects BRD2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen	BRD2
Dilution	Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	bromodomain containing 2, bromodomain-containing 2, bromodomain-containing protein 2, D6S113E, female sterile homeotic-related gene 1, FSRG1FSH, KIAA9001FLJ31942, NAT, O27.1.1, Really interesting new gene 3 protein, RING3DKFZp686N0336, RNF3
Gene Symbols	BRD2
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of human BRD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Concentration	0.1mg/mL
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	6046
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

BRD2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents