BRD2 Antibody (3D10), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00006046-M01

Product Code. 18430060

Description

BRD2 Monoclonal antibody specifically detects BRD2 in Human samples. It is validated for Western Blot, ELISA

Specifications

• Antigen: BRD2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: bromodomain containing 2, bromodomain-containing 2, bromodomain-containing protein 2, D6S113E, female sterile homeotic-related gene 1, FSRG1FSH, KIAA9001FLJ31942, NAT, O27.1.1, Really interesting new gene 3 protein, RING3DKFZp686N0336, RNF3
• Immunogen: BRD2 (NP_005095, 167 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS
• Quantity: 0.1 mg
• Research Discipline: DNA Repair, Protein Kinase
• Gene ID (Entrez): 6046
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2b κ

• Applications: Western Blot, ELISA
• Clone: 3D10
• Dilution: Western Blot 1:500
• Gene Accession No.: NP_005095
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified