missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. BRCAA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

BRCAA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18304425 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18304425 25 μg 25µL
18371652 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18304425 Supplier Novus Biologicals Supplier No. NBP31721825UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

BRCAA1 Polyclonal antibody specifically detects BRCAA1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen BRCAA1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 180 kDa Sin3-associated polypeptide, ARID domain-containing protein 4B, AT rich interactive domain 4B (RBP1- like), AT rich interactive domain 4B (RBP1-like), AT-rich interactive domain-containing protein 4B, BRCAA1DKFZp313M2420, breast cancer-associated antigen 1, Breast cancer-associated antigen BRCAA1, breast carcinoma-associated antigen, Histone deacetylase complex subunit SAP180, Rb-binding protein homolog, RBBP1L1RBP1L1BCAA, RBP1-like protein, retinoblastoma binding protein 1-like 1, Retinoblastoma-binding protein 1-like 1, SAP180MGC163290, SIN3A-associated protein 180, Sin3-associated polypeptide p180
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: NCKLRRLSKPPFQTNPSPEMVSKLDLTDAKNSDTAHIKSIEITSILNGLQASESSAEDSEQEDERGAQDM
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cancer, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 51742
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.