BRCAA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17218-25UL

Product Code. 18304425

Description

BRCAA1 Polyclonal antibody specifically detects BRCAA1 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: BRCAA1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: 180 kDa Sin3-associated polypeptide, ARID domain-containing protein 4B, AT rich interactive domain 4B (RBP1- like), AT rich interactive domain 4B (RBP1-like), AT-rich interactive domain-containing protein 4B, BRCAA1DKFZp313M2420, breast cancer-associated antigen 1, Breast cancer-associated antigen BRCAA1, breast carcinoma-associated antigen, Histone deacetylase complex subunit SAP180, Rb-binding protein homolog, RBBP1L1RBP1L1BCAA, RBP1-like protein, retinoblastoma binding protein 1-like 1, Retinoblastoma-binding protein 1-like 1, SAP180MGC163290, SIN3A-associated protein 180, Sin3-associated polypeptide p180
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NCKLRRLSKPPFQTNPSPEMVSKLDLTDAKNSDTAHIKSIEITSILNGLQASESSAEDSEQEDERGAQDM
• Quantity: 25 μg
• Research Discipline: Cancer, DNA Repair
• Gene ID (Entrez): 51742
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified