missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18390638

Bradykinin RB2/BDKRB2 Antibody (3F6), Novus Biologicals™

Product Code. 18390638 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18390638 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18390638 Supplier Novus Biologicals Supplier No. H00000624M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Bradykinin RB2/BDKRB2 Monoclonal antibody specifically detects Bradykinin RB2/BDKRB2 in Human samples. It is validated for Western Blot, Flow Cytometry, ELISA, Functional Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen Bradykinin RB2/BDKRB2
Applications Western Blot, Flow Cytometry, ELISA, Functional Assay
Classification Monoclonal
Clone 3F6
Conjugate Unconjugated
Dilution Western Blot 1:500, Flow Cytometry, ELISA, Functional
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000614
Gene Alias B2 bradykinin receptor, B2R, BK2, BK-2, BK-2 receptor, BKR2, bradykinin receptor B2, BRB2, DKFZp686O088
Host Species Mouse
Immunogen BDKRB2 (NP_000614, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 624
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 λ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.