Invitrogen™ Kininogen 1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA579571

Product Code. 15995135

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Mouse Lung Tissue, Mouse Testis Tissue, Mouse Liver Tissue, HEPA whole cell, NEURO whole cell. IHC: mouse kidney tissue.

This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. Three transcript variants encoding different isoforms have been found for this gene.

Specifications

• Antigen: Kininogen 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: KNG1
• Gene Alias: alpha-1-MAP; Alpha-2-thiol proteinase inhibitor; BDK; BK; Bradykinin; fitzgerald factor; high molecular weight kininogen; H-kininigen; HMWK; Ile-Ser-Bradykinin; Kallidin I; Kallidin II; kininogen; kininogen 1; kininogen 1-like 1; kininogen-1; Kininogen-1 heavy chain; Kininogen-1 light chain; Kng; Kng1; Kng1l1; L-kininogen; low molecular weight (LMW) T-kininogen II; Low molecular weight growth-promoting factor; Lysyl-bradykinin; Major acute phase protein; major acute phase protein (alpha-1-MAP); Thiostatin; T-kinin; T-kininogen 2; T-kininogen 2 heavy chain; T-kininogen 2 light chain; T-kininogen II; T-kininogen II heavy chain; T-kininogen II light chain; williams-Fitzgerald-Flaujeac factor
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 16644
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O08677
• Gene Symbols: KNG1
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Product Type: Antibody
• Isotype: IgG