BP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10328-100UL

Product Code. 18350856

Description

BP1 Polyclonal specifically detects BP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: BP1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: Beta protein 1, BP1distal-less homeo box 7, distal-less homeobox 4, DLX7distal-less homeo box 9, DLX8DLX9, homeobox protein DLX-4, Homeobox protein DLX-7, Homeobox protein DLX-8
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BP1 (NP_001925). Peptide sequence ERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVS
• Quantity: 100 μg
• Research Discipline: Adaptive Immunity, Cancer, Growth and Development, Hematopoietic Stem Cell Markers, Immunology, Neuronal Cell Markers, Stem Cell Markers
• Gene ID (Entrez): 1748
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified