missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
BMP-6 Monoclonal antibody specifically detects BMP-6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
Specifications
Specifications
| Antigen | BMP-6 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 6N5S9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | BMP-6, bone morphogenetic protein 6, vegetal related growth factor (TGFB-related), vegetal-related (TGFB related) cytokine, VG-1-R, VG-1-related protein, Vg1-related sequence, VGR, VGR1, VGR-1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human BMP-6 (P22004). DGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLN |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?