BMP-6 Rabbit anti-Human, Mouse, Rat, Clone: 6N5S9, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-16430-20UL

Product Code. 18387014

Description

BMP-6 Monoclonal antibody specifically detects BMP-6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: BMP-6
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunofluorescence
• Clone: 6N5S9
• Dilution: Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: BMP-6, bone morphogenetic protein 6, vegetal related growth factor (TGFB-related), vegetal-related (TGFB related) cytokine, VG-1-R, VG-1-related protein, Vg1-related sequence, VGR, VGR1, VGR-1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human BMP-6 (P22004). DGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLN
• Quantity: 20 μg
• Research Discipline: Cytokine Research
• Gene ID (Entrez): 654
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG