Invitrogen™ BMI-1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA595197

Product Code. 16364465

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human U2O whole cell, human PC-3 whole cell, human HEK293 whole cell, human Caco-2 whole cell, rat brain tissue, mouse brain tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.

Specifications

• Antigen: BMI-1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: BMI1
• Gene Alias: AW546694; B lymphoma Mo-MLV insertion region 1; B lymphoma Mo-MLV insertion region 1 homolog; Bmi1; Bmi-1; BMI1 polycomb ring finger oncogene; BMI1 polycomb ring finger proto-oncogene; BMI1 proto-oncogene, polycomb ring finger; FLVI2/BMI1; flvi-2/bmi-1; murine leukemia viral (bmi-1) oncogene homolog; Pcgf4; Pcgf4 antibody; Polycomb complex protein BMI-1; polycomb group protein Bmi1; polycomb group ring finger 4; polycomb group RING finger protein 4; RING finger protein 51; RNF51; RP11-573G6.1
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 12151, 307151, 648
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P25916, P35226
• Gene Symbols: BMI1
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bmi1 (135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG