missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. BMI-1 Antibody, Novus Biologicals™

BMI-1 Antibody, Novus Biologicals™

Product Code. 18421751 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18421751 0.1 mL 0.1mL
18445381 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18421751 Supplier Novus Biologicals Supplier No. NBP187321

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

BMI-1 Polyclonal antibody specifically detects BMI-1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen BMI-1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias B lymphoma Mo-MLV insertion region 1 homolog, B lymphoma Mo-MLV insertion region 1 homolog (mouse), BMI1 polycomb ring finger oncogene, FLVI2/BMI1, MGC12685, murine leukemia viral (bmi-1) oncogene homolog, PCGF4, polycomb complex protein BMI-1, polycomb group protein Bmi1, polycomb group ring finger 4, RING finger protein 51, RNF51Polycomb group RING finger protein 4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Hematopoietic Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 648
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.