BLZF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-83081-25ul

Product Code. 18478730

Description

BLZF1 Polyclonal specifically detects BLZF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BLZF1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: basic leucine zipper nuclear factor 1JEM-1s, cytoplasmic protein, GOLGIN-45, JEM1, JEM-1MGC22497, JEM-1short protein, p45 basic leucine-zipper nuclear factor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8548
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: BLZF1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVRSRKHHSLQSPWKKAVPSESPGVLQLGKMLTEKAMEVKAVRI
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only