missing translation for 'onlineSavingsMsg'
Learn More

BLIMP1/PRDM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18392333
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18392333 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18392333 Supplier Bio-Techne Supplier No. NBP317184100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

BLIMP1/PRDM1 Polyclonal antibody specifically detects BLIMP1/PRDM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen BLIMP1/PRDM1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Beta-interferon gene positive regulatory domain I-binding factor, beta-interferon gene positive-regulatory domain I binding factor, BLIMP-1, BLIMP1MGC118925, blmp-1, B-lymphocyte-induced maturation protein 1, MGC118922, MGC118923, Positive regulatory domain I-binding factor 1, PR domain containing 1, with ZNF domain, PR domain zinc finger protein 1, PR domain-containing protein 1, PRDI-BF1MGC118924, PRDI-binding factor 1, PRDI-binding factor-1, PR-domain zinc finger protein 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline B Cell Development and Differentiation Markers, Cancer, Chromatin Research, Cytokine Research, Diabetes Research, Immune System Diseases, Immunology, Innate Immunity, Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 639
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.