BLIMP1/PRDM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18392333	Bio-Techne NBP3-17184-100UL	100 μg

Description

BLIMP1/PRDM1 Polyclonal antibody specifically detects BLIMP1/PRDM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: BLIMP1/PRDM1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: B Cell Development and Differentiation Markers, Cancer, Chromatin Research, Cytokine Research, Diabetes Research, Immune System Diseases, Immunology, Innate Immunity, Zinc Finger
• Formulation: PBS, pH 7.2, 40% glycerol
• Gene ID (Entrez): 639
• Isotype: IgG
• Purification Method: Affinity purified

• Dilution: Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Beta-interferon gene positive regulatory domain I-binding factor, beta-interferon gene positive-regulatory domain I binding factor, BLIMP-1, BLIMP1MGC118925, blmp-1, B-lymphocyte-induced maturation protein 1, MGC118922, MGC118923, Positive regulatory domain I-binding factor 1, PR domain containing 1, with ZNF domain, PR domain zinc finger protein 1, PR domain-containing protein 1, PRDI-BF1MGC118924, PRDI-binding factor 1, PRDI-binding factor-1, PR-domain zinc finger protein 1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.