missing translation for 'onlineSavingsMsg'
Learn More

BJHCC20A Antibody, Novus Biologicals™

Product Code. 18375679 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18375679 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18375679 Supplier Novus Biologicals Supplier No. H00054967B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

BJHCC20A Polyclonal antibody specifically detects BJHCC20A in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen BJHCC20A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. NP_001026875
Gene Alias BJHCC20A, Cancer/testis antigen 55, chromosome X open reading frame 48, CT55, CT55 BRCA2-interacting protein, CXorf48, FLJ20527, RP13-565O16.1, Tumor antigen BJ-HCC-20
Host Species Mouse
Immunogen CXorf48 (NP_001026875, 1 a.a. - 264 a.a.) full-length human protein. MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEVCITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVHKSSSGFQDDGGLGRPKRERRSQSI
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54967
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.