Biliverdin Reductase A/BLVRA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38725-25ul

Product Code. 18605975

Description

Biliverdin Reductase A/BLVRA Polyclonal specifically detects Biliverdin Reductase A/BLVRA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Biliverdin Reductase A/BLVRA
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P53004
• Gene Symbols: BLVRA
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: biliverdin reductase A, Biliverdin-IX alpha-reductase, BLVR, BVR, BVR A, BVRA, EC 1.3.1.24
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 644
• Target Species: Human
• Isotype: IgG