BHMT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38850-25ul

Product Code. 18655765

Description

BHMT Polyclonal specifically detects BHMT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BHMT
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: Q93088
• Gene Symbols: BHMT
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: betaine homocysteine methyltransferase, betaine-homocysteine methyltransferase, betaine--homocysteine S-methyltransferase, betaine--homocysteine S-methyltransferase 1, BHMT1, EC 2.1.1, EC 2.1.1.5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 635
• Target Species: Human
• Isotype: IgG