missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BHLHB5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | BHLHB5 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
BHLHB5 Polyclonal specifically detects BHLHB5 in Human samples. It is validated for Western Blot.Specifications
| BHLHB5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Basic Helix-Loop-Helix Domain Containing, Class B, 5, basic helix-loop-helix family, member e22, Beta3, BHLHE22, CAGL85, Class B Basic Helix-Loop-Helix Protein 5, Class E Basic Helix-Loop-Helix Protein 22, TNRC20, Trinucleotide Repeat Containing 20, Trinucleotide Repeat-Containing Gene 20 Protein | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human BHLHB5 (NP_689627). Peptide sequence LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 27319 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title